PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G14340.1
Common NameAtMYB40, F18O22_130, MYB40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 263aa    MW: 30232.2 Da    PI: 5.4157
Description myb domain protein 40
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G14340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.85.1e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
      AT5G14340.1 14 RGPWTIEEDHRLMNFILNNGIHCWRIVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.91.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T  E++++ +++ qlG++ W++Ia+++  gRt++++k++w++
      AT5G14340.1  67 RGGFTDAEEDRIMELHSQLGNR-WSKIASHFS-GRTDNEIKNHWNT 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-20564IPR009057Homeodomain-like
PROSITE profilePS5129413.605961IPR017930Myb domain
SuperFamilySSF466891.61E-2711108IPR009057Homeodomain-like
SMARTSM007171.1E-51363IPR001005SANT/Myb domain
PfamPF002493.2E-111461IPR001005SANT/Myb domain
CDDcd001675.92E-41661No hitNo description
PROSITE profilePS5129425.12762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2565117IPR009057Homeodomain-like
SMARTSM007175.6E-1466114IPR001005SANT/Myb domain
PfamPF002494.4E-1467110IPR001005SANT/Myb domain
CDDcd001673.77E-970110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGRKPCCDKI GLKRGPWTIE EDHRLMNFIL NNGIHCWRIV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TDAEEDRIME LHSQLGNRWS KIASHFSGRT DNEIKNHWNT KIKKKMKHLG  120
LDPATHKPMN DITHQTDPNQ DKKPNMCSTI NEGEEIKDQT PKDDVITETT KTLMLSDNDE  180
ELVAKNCKIL CAEEVDLESL FETQCNEISS SSFSSLCSNI SRSESSSYLA EDSISLEQWD  240
LDMTDPFVPW DLFANLDDNL FLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306848540.0
Genevisible250173_at0.0
Expression AtlasAT5G14340-
AtGenExpressAT5G14340-
ATTED-IIAT5G14340-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G14340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT4G28110 (R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G14340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196220.0AY519622.1 Arabidopsis thaliana MYB transcription factor (At5g14340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196938.10.0myb domain protein 40
TrEMBLQ9LY950.0Q9LY95_ARATH; MYB transcription factor
STRINGAT5G14340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Lippold F, et al.
    AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.
    Plant Physiol., 2009. 149(4): p. 1761-72
    [PMID:19211694]
  6. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  7. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]